Login Register
English
0

Cart

$ 0

Mouse M-CSF protein

Mouse M-CSF protein

Views(314) Publications(1) Catalog no(PRP1136)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(1)
  • Comments(0)

Specification

Product name Mouse M-CSF protein
Sequence MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP withpolyhistidine tag at the C-terminus
Activity Measure by its ability to induce proliferation in NFS-60 cells.The ED₅₀ for this effect is <2 ng/mL.The specific activity of recombinant mouse M-CSF is approximately >5 x 10⁵ IU/mg.
Protein length The protein has a calculated MW of 19.02 kDa.The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative CSF-1, MGI-IM

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin:<0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight The protein has a calculated MW of 19.02 kDa.The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Usage notes Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution,  store at 2°C to 8°C for up to 1 week.  Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose  solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Gel pack with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Macrophage Colony-Stimulating Factor (M-CSF) is a 19.02 kDa hematopoietic Growth Factors with 162 amino acid residues. The active form of the protein is homodimer, and secreted by osteoblasts. M-CSF controls the production, differentiation, and function of monocytes, macrophages, and bone marrow progenitor cells. M-CSF is able to activate CSF-1 signaling pathway via binding its receptor CSF-1R.
Alternative CSF-1, MGI-IM
Accession P07141

Image & description

Fig.SDS-PAGE analysis of Mouse M-CSF protein

Fig.SDS-PAGE analysis of Mouse M-CSF protein

This product has been cited in1publications

Reviews

There are no reviews yet.

Be the first to review “Mouse M-CSF protein”