Login Register
English
0

Cart

$ 0

Mouse IFN-γ

Mouse IFN-γ

Views(269) Publications(0) Catalog no(PRP1138)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Mouse IFN-γ
Sequence MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC with polyhistidine tag at the C-terminus.
Activity Measure by its ability to anti-viral assay in L-929 cells infected with encephalomyocarditis (EMC) virus.The ED₅₀ for this effect is <0.5 ng/mL.The specific activity of recombinant mouse IFN gamma is approximately >2x 10⁶ IU/mg.
Protein length The protein has a calculated MW of 16.5 kDa.The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative Type II interferon, T-cell interferon, MAF, Ifg, If2f, IFN-g

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin:<0.01 EU per 1 μg of the protein by the LAL method.
Molecular weight The protein has a calculated MW of 16.5 kDa.The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).
Usage notes Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution,  store at 2°C to 8°C for up to 1 week.  Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose  solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Gel pack with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.
Alternative Type II interferon, T-cell interferon, MAF, Ifg, If2f, IFN-g
Accession P01580

Image & description

Fig.SDS-PAGE analysis of Mouse IFN-γ

Fig.SDS-PAGE analysis of Mouse IFN-γ

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Mouse IFN-γ”