Login Register
English
0

Cart

$ 0

Human/Mouse/Rat BDNF protein

Human/Mouse/Rat BDNF protein

Views(313) Publications(1) Catalog no(PRP1066)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(1)
  • Comments(0)

Specification

Product name Human/Mouse/Rat BDNF protein
Sequence MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR with polyhistidine tag at the C-terminus.
Activity Measure by its ability to induce proliferation in BaF3 cells transfected with TrkB.The ED₅₀ for this effect is <2 ng/mL.
Protein length The protein has a calculated MW of 14.45 kDa.The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative ANON2, BULN2

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin:<0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight The protein has a calculated MW of 14.45 kDa.The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis).
Usage notes Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution,  store at 2°C to 8°C for up to 1 week.  Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose  solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Gel pack with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Brain-derived neurotrophic factor (BDNF) is a member of neurotrophin family that not only primarily expressed in hippocampus, amygdala, cerebral cortex, hypothalamus and cerebellum but also has been detected in blood platelets and in circulating plasma. BDNF is a 27.8 kDa protein containing 247 residues, which plays a critical role in regulating synaptic transmission and plasticity in various region of the CNS. Additionally, BNDF can acts as a modulator in the long-term potentiation of memory-related modifications in hippocampal synaptic transmission.
Alternative ANON2, BULN2
Accession P23560(Human), P21237(Mouse),  P23363(Rat) Q9510⁶

Image & description

Fig.SDS-PAGE analysis of Human/Mouse/Rat BDNF protein

Fig.SDS-PAGE analysis of Human/Mouse/Rat BDNF protein

This product has been cited in1publications

Reviews

There are no reviews yet.

Be the first to review “Human/Mouse/Rat BDNF protein”