Login Register
English
0

Cart

$ 0

Human β-NGF protein

Human β-NGF protein

Views(323) Publications(0) Catalog no(PRP1061)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human β-NGF protein
Sequence MSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA with polyhistidine tag at the C-terminus.
Activity Measure by its ability to induce TF-1 cells proliferation.The ED₅₀ for this effect is <0.7 ng/mL.The specific activity of recombinant human beta-NGF is > 1 x 10⁶ IU/mg.
Protein length The protein has a calculated MW of 14.43 kDa.The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative β-Nerve Growth Factor, NGF-β

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin:<0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight The protein has a calculated MW of 14.43 kDa.The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Usage notes Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution,  store at 2°C to 8°C for up to 1 week.  Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose  solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Gel pack with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Nerve Growth Factors (NGF) is critical for the development and maintenance of the sympathetic and sensory neuron systems. NGF has been demonstrated as a complex that consists of three polypeptides named α, β and γ subunits. Among then, β subunit, which known as beta-NGF is a 26.9 kDa protein containing 241 residues that involve in neuronal survival and differentiation. Besides, beta-NGF also acts as a ligand to TRKA receptor, which indispensable for the differentiation and development of pain and temperature sensing neurons.
Alternative β-Nerve Growth Factor, NGF-β
Accession P01138

Image & description

Fig.SDS-PAGE analysis of Human β-NGF protein

Fig.SDS-PAGE analysis of Human β-NGF protein

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human β-NGF protein”