Login Register
English
0

Cart

$ 0

Mouse IFN alpha 1a Protein, His tag (Animal-Free)

Mouse IFN alpha 1a Protein, His tag (Animal-Free)

Views(238) Publications(0) Catalog no(PRP1161)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Mouse IFN alpha 1a Protein, His tag (Animal-Free)
Sequence CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK with polyhistidine tag at the N-terminus.
Activity Measure by its ability to protect L929 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <10 pg/mL. The specific activity of recombinant mouse IFN alpha 1a is > 4 x 10⁷ IU/mg.
Protein length The protein has a calculated MW of 19.93 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative Ifa, Ifa8

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 19.93 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Mouse IFN alpha 1a Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Interferon Alpha 1a (IFN alpha 1a) is a leukocyte interferon, which is a variant of Interferon-alpha. IFN-alpha 1a is a 18.4 kDa protein containing 166 amino acid residues. It could bind the interferon receptors that activates the signal transduction of immune responses through the Jak/STAT pathway in leukocytes and lymphoblastoid cells.
Alternative Ifa, Ifa8
Accession P01572

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Mouse IFN alpha 1a Protein, His tag (Animal-Free)”