Login Register
English
0

Cart

$ 0

Mouse Flt-3 Ligand protein

Mouse Flt-3 Ligand protein

Views(216) Publications(0) Catalog no(PRP1149)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Mouse Flt-3 Ligand protein
Sequence MGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR with polyhistidine tag at the C-terminus.
Activity Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3.The ED₅₀ for this effect is <2 ng/mL.
Protein length The protein has a calculated MW of 19.3 kDa.The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative Fetal liver kinase 2, FLK-2

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin:<0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight The protein has a calculated MW of 19.3 kDa.The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Usage notes Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution,  store at 2°C to 8°C for up to 1 week.  Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose  solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Gel pack with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Fms-related tyrosine kinase-3 ligand (Flt-3 Ligand) is a protein which is encoded by the Flt3lg gene in mouse. As an important regulator of hematopoiesis, Flt-3 ligand has a tyrosine-protein kinase activity that stimulate the proliferation of hematopoietic progenitor cells of both lymphoid and myeloid origin. Flt-3 ligand can synergistically increase the proliferation of immature progenitors with other cytokines such as GM-CSF, G-CSF, IL-3, EPO, IL-11, IL-12, IL-6 or TPO. Flt-3 ligand is expressed by a variety of hematopoietic progenitor cells including immature hematopoietic and marrow stromal cells.
Alternative Fetal liver kinase 2, FLK-2
Accession P49772

Image & description

Fig.SDS-PAGE analysis of Mouse Flt-3 Ligand protein

Fig.SDS-PAGE analysis of Mouse Flt-3 Ligand protein

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Mouse Flt-3 Ligand protein”