Login Register
English
0

Cart

$ 0

Mouse CCL2 protein

Mouse CCL2 protein

Views(202) Publications(0) Catalog no(PRP1148)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Mouse CCL2 protein
Sequence QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN with polyhistidine tag at the N-terminus.
Activity Measure by its ability to chemoattract BaF3 cells transfected with CCR2A. The ED₅₀ for this effect is <8 ng/mL.
Protein length The protein has a calculated MW of 14.65 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative Monocyte Chemotactic Protein-1,MCP-1,JE

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin:<0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight The protein has a calculated MW of 14.65 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Usage notes Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution,  store at 2°C to 8°C for up to 1 week.  Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose  solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Gel pack with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background C-C Motif Chemokine Ligand 2 (CCL2) is a 13.88 kDa cytokine with 125 amino acid residues and is also known as monocyte chemoattractant protein 1 (MCP1). CCL2 is mainly secreted from monocytes, macrophages, and dendritic cells. It regulates many biological functions, such as recruitments of monocytes, memory T cells, eosinophils, and dendritic cells, extravasation of helper T cells, response to TNFα and IFNγ, and angiogenesis. In addition, upon binding with CCR4, it initiates leukocyte migration response to inflammation.
Alternative Monocyte Chemotactic Protein-1,MCP-1,JE
Accession P10148

Image & description

Fig.SDS-PAGE analysis of Mouse CCL2 protein

Fig.SDS-PAGE analysis of Mouse CCL2 protein

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Mouse CCL2 protein”