Login Register
English
0

Cart

$ 0

Human IL-6 Protein, His tag (Animal-Free)

Human IL-6 Protein, His tag (Animal-Free)

Views(102) Publications(0) Catalog no(PRP1087)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human IL-6 Protein, His tag (Animal-Free)
Sequence MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM with polyhistidine tag at the C-terminus.
Activity Measure by its ability to induce proliferation in TF-1 cells. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant human IL-6 is approximately >5 x 10⁸ IU/mg. Measure by its ability to induce proliferation in MCF-7 cells. The ED₅₀ for this effect is <4.4 ng/mL.
Protein length The protein has a calculated MW of 21.8 kDa. The protein migrates as 22 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative IFN-β2, B-Cell Differentiation Factor (BCDF), BSF-2, HPGF, HSF, MGI-2

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 21.8 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human IL-6 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Interleukin-6 (IL-6) is a pleiotropic, 22-28 kDa cytokine which plays fundamental role in the acute phase response, inflammation, bone metabolism, lymphocyte differentiation and cancer progression. Deregulation of IL-6 production was also found in several diseases, including rheumatoid arthritis, Alzheimer’s disease, autoimmune deficiency disease and different types of cancer.
Alternative IFN-β2, B-Cell Differentiation Factor (BCDF), BSF-2, HPGF, HSF, MGI-2
Accession P05231

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human IL-6 Protein, His tag (Animal-Free)”