| Product name | Human IL-33 Protein, His tag (Animal-Free) |
| Sequence | MSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET with polyhistidine tag at the C-terminus. |
| Activity | Measure by its ability to binding with recombinant ST2L (IL-33 receptor). The ED₅₀ for this effect is <54 ng/mL. Measure by its ability to induce proliferation in D10.G4.1 cells. The ED₅₀ for this effect is < 0.1 ng/mL. The specific activity of recombinant human IL-33 is approximately >4 x10⁷ IU/ mg. |
| Protein length | The protein has a calculated MW of 18.93 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis). |
| Preparation method | E. coli |
| Purity | >98% as determined by SDS-PAGE. |
| Alternative | IL-1 F11, NF-HEV, DVS27 |
| Formulation | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Features & Benefits | Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method. |
| Molecular weight | 18.93 kDa |
| Usage notes | Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human IL-33 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Storage instructions | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Shipping | The product is shipped with blue ice. |
| Precautions | The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product. |
| Background | Interleukin 33 (IL-33) is an 18 kDa cytokine with 169 amino acid residues. Interleukin-33 is a member of the IL-1 cytokine family and is primarily expressed in endothelial cells, epithelial cells, fibroblasts, and mesenchymal cells. When IL-33 binds to its receptor, ST2L, it activates mast cells and innate lymphoid cells and subsequently generates IL-5 and IL-13, which play essential roles in allergic inflammation. IL-33 also acts as an alarm by alerting the immune system of cellular damage and plays a critical role in type-2 innate immunity. |
| Alternative | IL-1 F11, NF-HEV, DVS27 |
| Accession | O95760 |
You must be logged in to post a review.
1.The species of antibody reactivity should be the sample species that can be matched normally after Abbkine R&D experts have passed strict scientific verification. If your sample is not within the range of reactivity, in order to improve the efficiency and results of your experiment, it is not suggested to try other species. Otherwise, it may lead to sample mismatch and affect the effect of your experiment.
2.Please aliquot the antibody received as soon as possible and store it at -20℃, avoid repeated freezing and thawing, and use it within one year.
Welcome any form of communications, and better service will be provided here.
Tell： +1-404-854-0155
Email： service@abbkine.com
Support Email： support@abbkine.com
Address： 3052 Stroop Hill Road, Apt 203, Atlanta 30303, Georgia, United States of America
Reviews
There are no reviews yet.