Login Register
English
0

Cart

$ 0

Human IL-33 Protein, His tag (Animal-Free)

Human IL-33 Protein, His tag (Animal-Free)

Views(618) Publications(0) Catalog no(PRP1091)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human IL-33 Protein, His tag (Animal-Free)
Sequence MSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET with polyhistidine tag at the C-terminus.
Activity Measure by its ability to binding with recombinant ST2L (IL-33 receptor). The ED₅₀ for this effect is <54 ng/mL. Measure by its ability to induce proliferation in D10.G4.1 cells. The ED₅₀ for this effect is < 0.1 ng/mL. The specific activity of recombinant human IL-33 is approximately >4 x10⁷ IU/ mg.
Protein length The protein has a calculated MW of 18.93 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative IL-1 F11, NF-HEV, DVS27

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 18.93 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human IL-33 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Interleukin 33 (IL-33) is an 18 kDa cytokine with 169 amino acid residues. Interleukin-33 is a member of the IL-1 cytokine family and is primarily expressed in endothelial cells, epithelial cells, fibroblasts, and mesenchymal cells. When IL-33 binds to its receptor, ST2L, it activates mast cells and innate lymphoid cells and subsequently generates IL-5 and IL-13, which play essential roles in allergic inflammation. IL-33 also acts as an alarm by alerting the immune system of cellular damage and plays a critical role in type-2 innate immunity.
Alternative IL-1 F11, NF-HEV, DVS27
Accession O95760

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human IL-33 Protein, His tag (Animal-Free)”