Login Register
English
0

Cart

$ 0

Human MIF Protein, His tag (Animal-Free)

Human MIF Protein, His tag (Animal-Free)

Views(652) Publications(0) Catalog no(PRP1907)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human MIF Protein, His tag (Animal-Free)
Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA with polyhistidine tag at the C-terminus.
Activity Testing in process
Protein length The protein has a calculated MW of 13.28 kDa. The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative GLIF, mMIF, GIF, Glycosylation-inhibiting factor

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 13.28 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human MIF Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Macrophage migration inhibitory factor (MIF) is a pleiotropic inflammatory mediator, predicts a molecular mass of 12.5 kDa. MIF binds to CD74, a type II transmembrane protein, inducing its phosphorylation and the recruitment of CD44, which then activates SRC family non-receptor tyrosine kinases, leading to ERK1 /2 phosphorylation.
Alternative GLIF, mMIF, GIF, Glycosylation-inhibiting factor
Accession P14174

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human MIF Protein, His tag (Animal-Free)”