Login Register
English
0

Cart

$ 0

Mouse/Rat FGF-2 protein

Mouse/Rat FGF-2 protein

Views(265) Publications(0) Catalog no(PRP1150)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Mouse/Rat FGF-2 protein
Sequence ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS with polyhistidine tag at the N-terminus.
Activity Measure by its ability to induce 3T3 cells proliferation.The ED₅₀ for this effect is <1.5 ng/mL.The specific activity of recombinant mouse FGF-2 is approximately >1 x 10⁶ IU/mg.
Protein length The protein has a calculated MW of 17.2 kDa.The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative HBGF-2, Prostatropin

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 0.01% sarkosyl in 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin:<0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight The protein has a calculated MW of 17.2 kDa.The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Usage notes Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution,  store at 2°C to 8°C for up to 1 week.  Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose  solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Gel pack with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Basic fibroblast Growth Factors (FGF-2, bFGF), a pleiotropic cytokine, plays multiple roles in different cells and tissues. FGF-2 can stimulate smooth muscle cell growth, wound healing, and tissue repair. In addition, FGF-2 has been shown to regulate the generation of neurons and astrocytes from progenitor cells. FGF-2 are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion. As a multifunctional cytokine, FGF-2 is first isolated from the pituitary. Later, it was identified from various cell types including cardiac myocytes, cardiac fibroblasts, endothelial cells, and smooth muscle cells.
Alternative HBGF-2, Prostatropin
Accession P15655(Mouse), P13109.1(Rat)

Image & description

Fig.SDS-PAGE analysis of Mouse/Rat FGF-2 protein

Fig.SDS-PAGE analysis of Mouse/Rat FGF-2 protein

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Mouse/Rat FGF-2 protein”