Login Register
English
0

Cart

$ 0

Mouse IL-18 Protein, His tag (Animal-Free)

Mouse IL-18 Protein, His tag (Animal-Free)

Views(271) Publications(0) Catalog no(PRP1167)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Mouse IL-18 Protein, His tag (Animal-Free)
Sequence MNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS with polyhistidine tag at the C-terminus.
Activity Measure by its ability to induce IFN gamma secretion in KG-1 cells. The ED₅₀ for this effect is <0.5 μg/mL.
Protein length The protein has a calculated MW of 19.1 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative IGIF

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 19.1 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Mouse IL-18 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Interleukin-18 (IL-18) belongs to the IL-1 superfamily and is constitutively produced by macrophages, dendritic cells (DCs) and other cells. IL-18 binds to the receptor of IL-18 (IL-18R) and initiate the recruitment and heterodimerization of the IL-18RAcP, leading to downstream activation of NF-κB. After stimulation with IL-18, multiple cytokines including IFN-γ, IL-13, IL-4, IL-8, and GM-CSF and both Th1 and Th2 lymphokines could be produced by different cells. As an immunoregulaory cytokine, IL-18 can promote development of T helper 1 (Th1) cells, which maximizes the production of IFN by synergistically stimulating to mature Th1 effectors in combination with IL-12. On the contrary, it inhibits the production of the anti-inflammatory cytokine IL-10. In addition, IL-18 exhibits multiple proinflammatory functions, such as increases in cell adhesion molecules, nitric oxide synthesis, and chemokine production.
Alternative IGIF
Accession P70380

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Mouse IL-18 Protein, His tag (Animal-Free)”