Login Register
English
0

Cart

$ 0

Mouse IL-13 Protein, His tag (Animal-Free)

Mouse IL-13 Protein, His tag (Animal-Free)

Views(653) Publications(0) Catalog no(PRP1159)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Mouse IL-13 Protein, His tag (Animal-Free)
Sequence MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF with polyhistidine tag at the C-terminus.
Activity Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <4 ng/mL. The specific activity of recombinant mouse IL-13 is > 2.5 x 10⁵ IU/mg.
Protein length The protein has a calculated MW of 13.06 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >95% as determined by SDS-PAGE.
Alternative P600

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 13.06 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Mouse IL-13 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Interleukin 13 (IL-13) with a molecular mass of 10 kDa cytokine, it secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. It is homologous to IL-4 and shares many of its biologic activities on mononuclear phagocytic cells, endothelial cells, epithelial cells, and B cells.
Alternative P600
Accession P20109

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Mouse IL-13 Protein, His tag (Animal-Free)”