Login Register
English
0

Cart

$ 0

Mouse FGF-21 Protein, His tag (Animal-Free)

Mouse FGF-21 Protein, His tag (Animal-Free)

Views(659) Publications(0) Catalog no(PRP1166)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Mouse FGF-21 Protein, His tag (Animal-Free)
Sequence AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS with polyhistidine tag at the N-terminus
Activity Measure by its ability to induce proliferation in NIH‑3T3 mouse embryonic fibroblast cells in the presence of mouse Klotho beta and heparin. The ED₅₀ for this effect is < 2 μg/mL.
Protein length The protein has a calculated MW of 20.76 kDa. The protein migrates as 25-35 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative Fgf8c

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 20.76 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Mouse FGF-21 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Fibroblast Growth Factors 21 (FGF-21) is a 23 kDa protein with 210 amino acid residues. Belongs to FGF superfamily, FGF-21 is related to glucose and lipid metabolism. Peroxisome proliferator-activated receptor gamma (PPARg) and peroxisome proliferator-activated receptor alpha (PPARa) regulate FGF-21 expression.
Alternative Fgf8c
Accession Q9JJN1

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Mouse FGF-21 Protein, His tag (Animal-Free)”