Product name | Mouse β-NGF protein |
Sequence | MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG with polyhistidine tag at the C-terminus. |
Activity | Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <1ng/mL. The specific activity of recombinant mouse beta-NGF is > 1 x 10⁶ IU/mg. |
Protein length | The protein has a calculated MW of 14.41 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis). |
Preparation method | E. coli |
Purity | >98% as determined by SDS-PAGE. |
Alternative | β-Nerve Growth Factor, NGF-β |
Formulation | The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. If you have any concerns or special requirements, please confirm with us. |
Features & Benefits | Endotoxin:<0.1 EU per 1 μg of the protein by the LAL method. |
Molecular weight | The protein has a calculated MW of 14.41 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis). |
Usage notes | Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein. |
Storage instructions | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
Shipping | Gel pack with blue ice. |
Precautions | The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product. |
Background | Beta-Nerve Growth Factors (Beta-NGF) is a 27 kDa cytokine with 241 amino acid residues. Beta-NGF belongs to neurotrophin family, and acts as neurotrophic factors. It's composed of alpha, beta, gamma subnuits, and the beta subunit is related to its biological activity. Beta-NGF binds to p75 neurotrophin receptor and Trk receptor and their function is about cell death and survival, respectively. |
Alternative | β-Nerve Growth Factor, NGF-β |
Accession | P01139 |
Fig.SDS-PAGE analysis of Mouse β-NGF protein
You must be logged in to post a review.
1.The species of antibody reactivity should be the sample species that can be matched normally after Abbkine R&D experts have passed strict scientific verification. If your sample is not within the range of reactivity, in order to improve the efficiency and results of your experiment, it is not suggested to try other species. Otherwise, it may lead to sample mismatch and affect the effect of your experiment.
2.Please aliquot the antibody received as soon as possible and store it at -20℃, avoid repeated freezing and thawing, and use it within one year.
Welcome any form of communications, and better service will be provided here.
Tell: +1-404-854-0155
Email: service@abbkine.com
Support Email: support@abbkine.com
Address: 3052 Stroop Hill Road, Apt 203, Atlanta 30303, Georgia, United States of America
Reviews
There are no reviews yet.