Login Register
English
0

Cart

$ 0

Human TPO protein

Human TPO protein

Views(352) Publications(0) Catalog no(PRP1058)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human TPO protein
Sequence SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL with polyhistidine tag at the N-terminus.
Activity Testing in process
Protein length The protein has a calculated MW of 19.6 kDa.The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >95% as determined by SDS-PAGE.
Alternative Megakaryocyte colony-stimulating factor, c-MPL Ligand, MGDF, THPO

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin:<0.01 EU per 1 μg of the protein by the LAL method.
Molecular weight The protein has a calculated MW of 19.6 kDa.The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Usage notes Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution,  store at 2°C to 8°C for up to 1 week.  Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose  solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Gel pack with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Thrombopoietin (TPO) is a glycoprotein that produced by the liver, kidney, marrow stroma and several other tissues. The TPO level in the blood is mostly negatively correlated with the abundance of platelets and bone marrow megakaryocytes, although multiple states of inflammation or infection, liver failure, and hematological disturbances are associated with unexpectedly high or low circulating levels of the hormone.
Alternative Megakaryocyte colony-stimulating factor, c-MPL Ligand, MGDF, THPO
Accession P40225

Image & description

Fig.SDS-PAGE analysis of Human TPO protein

Fig.SDS-PAGE analysis of Human TPO protein

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human TPO protein”