Login Register
English
0

Cart

$ 0

Human Noggin protein

Human Noggin protein

Views(296) Publications(0) Catalog no(PRP1059)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human Noggin protein
Sequence MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC with Fc tag at the C-terminus.
Activity Measure by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 cells.The ED₅₀ for this effect is <0.05 μg/mL in the presence of 50 ng/mL of recombinant human BMP-4.
Protein length The protein has a calculated MW of 49.11 kDa.The protein migrates as 27 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative NOG,  Noggin, SYM1, symphalangism 1 (proximal), synostoses (multiple) syndrome 1, SYNS1, SYNS1A

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin:<0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight The protein has a calculated MW of 49.11 kDa.The protein migrates as 27 kDa under reducing condition (SDS-PAGE analysis).
Usage notes Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution,  store at 2°C to 8°C for up to 1 week.  Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose  solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Gel pack with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Noggin is a 46.2 kDa bioactive protein, which exists as a disulfide-linked homodimer (each chain 23.1 kDa). Noggin binds members of the transforming Growth Factors-beta (TGF beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP-4), which inactivates their activities. As a extracellular antagonist of BMP proteins, Noggin involves in the development of many body tissues, including nerve tissue, muscles, and bones. In addition, Noggin is able to inhibit chondrocyte differentiation through its interaction with GDF5.
Alternative NOG,  Noggin, SYM1, symphalangism 1 (proximal), synostoses (multiple) syndrome 1, SYNS1, SYNS1A
Accession Q13253

Image & description

Fig.SDS-PAGE analysis of Human Noggin protein

Fig.SDS-PAGE analysis of Human Noggin protein

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human Noggin protein”