| Product name |
Human IL-32α Protein, His tag (Animal-Free) |
| Sequence |
MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK with polyhistidine tag at the C-terminus . |
| Activity |
Measure by its ability to induce TNF alpha secretion in RAW264.7 cells.
The ED₅₀ for this effect is <10 μg/mL. |
| Protein length |
The protein has a calculated MW of 15.72 kDa.
The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis). |
| Preparation method |
E. coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Alternative |
IL-32alpha, IL-32beta, IL-32delta, IL-32gamma, NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd |
| Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Features & Benefits |
Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method. |
| Molecular weight |
15.72 kDa |
| Usage notes |
Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human IL-32α Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Storage instructions |
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Shipping |
The product is shipped with blue ice. |
| Precautions |
The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product. |
| Background |
Interleukin 32 alpha (IL-32α) is an 18 kDa cytokine with 131 amino acid residues and one of the IL-2 splice variants. IL-32α is primarily secreted from inflammatory cells, such as NK cells, T-cells, peripheral blood mononuclear cells (PBMCs), and monocytes. IL-32 alpha is a proinflammatory cytokine regulating IL-6 by interaction with protein kinase C(PKC). It also interacts with paxillin, integrin, and focal adhesion kinase 1 (FAK 1). |
| Alternative |
IL-32alpha, IL-32beta, IL-32delta, IL-32gamma, NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd |
| Accession |
P24001-4 |
Reviews
There are no reviews yet.