Login Register
English
0

Cart

$ 0

Human IL-32α Protein, His tag (Animal-Free)

Human IL-32α Protein, His tag (Animal-Free)

Views(201) Publications(0) Catalog no(PRP1904)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human IL-32α Protein, His tag (Animal-Free)
Sequence MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK with polyhistidine tag at the C-terminus .
Activity Measure by its ability to induce TNF alpha secretion in RAW264.7 cells. The ED₅₀ for this effect is <10 μg/mL.
Protein length The protein has a calculated MW of 15.72 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative IL-32alpha, IL-32beta, IL-32delta, IL-32gamma, NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 15.72 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human IL-32α Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Interleukin 32 alpha (IL-32α) is an 18 kDa cytokine with 131 amino acid residues and one of the IL-2 splice variants. IL-32α is primarily secreted from inflammatory cells, such as NK cells, T-cells, peripheral blood mononuclear cells (PBMCs), and monocytes. IL-32 alpha is a proinflammatory cytokine regulating IL-6 by interaction with protein kinase C(PKC). It also interacts with paxillin, integrin, and focal adhesion kinase 1 (FAK 1).
Alternative IL-32alpha, IL-32beta, IL-32delta, IL-32gamma, NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd
Accession P24001-4

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human IL-32α Protein, His tag (Animal-Free)”