Login Register
English
0

Cart

$ 0

Human IL-23 p19 Protein, His tag (Animal-Free)

Human IL-23 p19 Protein, His tag (Animal-Free)

Views(248) Publications(0) Catalog no(PRP1909)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human IL-23 p19 Protein, His tag (Animal-Free)
Sequence RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP with polyhistidine tag at the N-terminus.
Activity Measured by its ability to induce IL-17 secretion in mouse splenocytes. The ED₅₀ for this effect is <0.5 ng/mL.
Protein length The protein has a calculated MW of 19.49 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >95% as determined by SDS-PAGE.
Alternative IL-23, IL-23A, SGRF

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 19.49 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human IL-23 p19 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Interleukin 23 p19(IL-23p19) predicts a molecular mass of 20.7 kDa. Interleukin 23 is a heterodimeric cytokine composed of an IL-12p40 subunit that is shared with IL-12 and the IL-23p19 subunit. The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4 and stimulate the production of interferon-gamma (IFN-gamma).
Alternative IL-23, IL-23A, SGRF
Accession Q9NPF7

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human IL-23 p19 Protein, His tag (Animal-Free)”