Login Register
English
0

Cart

$ 0

Human IL-1β protein

Human IL-1β protein

Views(298) Publications(0) Catalog no(PRP1060)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human IL-1β protein
Sequence MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS with polyhistidine tag at the C-terminus.
Activity Measure by its ability to induce IL-8 secretion in HT29 cells. The ED₅₀ for this effect is <2.0 ng/mL. The specific activity of recombinant human IL-1 beta is approximately >3 x 10⁷ IU/mg.
Protein length The protein has a calculated MW of 18.5 kDa.The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >98% as determined by SDS-PAGE.
Alternative Catabolin, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF)

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin:<0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight The protein has a calculated MW of 18.5 kDa.The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Usage notes Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution,  store at 2°C to 8°C for up to 1 week.  Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose  solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Gel pack with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Interleukin-1 beta (IL-1β) is a major cytokine expressed in macrophage, NK cells, monocytes, and neutrophils. It also plays fundamental role in inflammatory response, including monocyte activation, which is essential for the host defense and pathogen and pathogen resistance. Pro-IL-1β is cleaved by cytosolic caspase 1 to form mature IL-1β.
Alternative Catabolin, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF)
Accession P01584

Image & description

Fig.SDS-PAGE analysis of Human IL-1β protein

Fig.SDS-PAGE analysis of Human IL-1β protein

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human IL-1β protein”