Login Register
English
0

Cart

$ 0

Human IFN-α1a Protein, His tag (Animal-Free)

Human IFN-α1a Protein, His tag (Animal-Free)

Views(263) Publications(0) Catalog no(PRP1902)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Human IFN-α1a Protein, His tag (Animal-Free)
Sequence CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE with polyhistidine tag at the N-terminus.
Activity Measure by its ability to inhibit IL-8 secretion in human PBMCs in the presence of LPS. The ED₅₀ for this effect is <1.12 μg /mL.
Protein length The protein has a calculated MW of 20.19 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >95% as determined by SDS-PAGE.
Alternative Leukocyte Interferon, IFNA2, B cell Interferon, Type I Interferon

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 20.19 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human IFN-α1a Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Interferon-alpha 1a (IFN-alpha 1a) is a leukocyte interferon, which is a variant of Interferon-alpha. IFN-alpha 1a is a 19.5kDa protein containing 167 amino acid residues. It could bind the interferon receptors that activates the signal transduction of immune responses through the Jak/STAT pathway in leukocytes and lymphoblastoid cells.
Alternative Leukocyte Interferon, IFNA2, B cell Interferon, Type I Interferon
Accession P01562

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Human IFN-α1a Protein, His tag (Animal-Free)”