Login Register
English
0

Cart

$ 0

Mouse LIF Protein, His tag (Animal-Free)

Mouse LIF Protein, His tag (Animal-Free)

Views(592) Publications(0) Catalog no(PRP1160)
Datasheet Print Share Email Share
  • Specification
  • FAQ
  • Publications(0)
  • Comments(0)

Specification

Product name Mouse LIF Protein, His tag (Animal-Free)
Sequence SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF with polyhistidine tag at the N-terminus.
Activity Measure by its ability to induce IL-6 secretion in M1 cells. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant mouse LIF is > 2 x 10⁶ IU/mg.
Protein length The protein has a calculated MW of 20.68 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Preparation method E. coli
Purity >95% as determined by SDS-PAGE.
Alternative leukemia inhibitory factor, Differentiation-stimulating factor, D factor, Melanoma-derived LPL inhibitor (MLPLI), Interleukin 6 family cytokine

Product Properties

Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Features & Benefits Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Molecular weight 20.68 kDa
Usage notes Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Mouse LIF Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Storage instructions Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping The product is shipped with blue ice.
Precautions The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.

Additional Information

Background Leukemia inhibitory factor (LIF) is a pleiotropic glycoprotein, belonging to the IL-6 receptor family. Mouse LIF shares 79% sequence homology with human LIF. LIF is a 19.7 kDa protein containing 202 amino acid which high expression in human liver, bone, uterus, kidney and the central nervous system. LIF is a inducer of differentiation in M1 leukaemia cells, osteoblasts and glia. Not only stimulates proliferation of DA1 cells inhibit proliferation of corticotrophs and promote cell survival in some cell types but also induces apoptosis in others.
Alternative leukemia inhibitory factor, Differentiation-stimulating factor, D factor, Melanoma-derived LPL inhibitor (MLPLI), Interleukin 6 family cytokine
Accession P09056

Image & description

This product has been cited in0publications

Reviews

There are no reviews yet.

Be the first to review “Mouse LIF Protein, His tag (Animal-Free)”