Product name |
Human IL-3 Protein, His tag (Animal-Free) |
Sequence |
MAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF with polyhistidine tag at the C-terminus. |
Activity |
Measure by its ability to induce TF-1 cells proliferation.
The ED₅₀ for this effect is <0.15 ng/mL.
The specific activity of recombinant human IL-3 is approximately >1.2 x 10⁶ IU/mg. |
Protein length |
The protein has a calculated MW of 16 kDa.
The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis). |
Preparation method |
E. coli |
Purity |
>98% as determined by SDS-PAGE. |
Alternative |
MCGF (Mast Cell Growth Factor), Multi-CSF, HCGF, P-cell stimulation factor, Interleukin-3b |
Formulation |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
Features & Benefits |
Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method. |
Molecular weight |
16 kDa |
Usage notes |
Always centrifuge tubes before opening. It is recommended to reconstitute the lyophilized Human IL-3 Protein, His tag (Animal-Free) using the buffer we provided not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
Storage instructions |
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
Shipping |
The product is shipped with blue ice. |
Precautions |
The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product. |
Reviews
There are no reviews yet.